PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_16800V3.3.p
Common NamePHYPADRAFT_64527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2119aa    MW: 233767 Da    PI: 6.5611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_16800V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.4e-08876917346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +WT+ E +++v+ ++++ ++ +k Ia++++  +t  +c+++++ 
  Pp3c7_16800V3.3.p 876 PWTEVEKKIFVEKFALHYKN-FKEIASHLQ-YKTTADCIEYYYR 917
                        8*****************99.*********.9**********96 PP

2Myb_DNA-binding38.23.3e-1211021144347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                          WT eE el+  av+ +G++ +++Ia+++g  ++  qcks++ k 
  Pp3c7_16800V3.3.p 1102 QWTDEERELFTSAVATHGKD-FRLIAAHVG-SKSQSQCKSFFSKT 1144
                         6*****************99.*********.**********9886 PP

3Myb_DNA-binding30.11.1e-0914291470346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                         +WT+eE e+++   +++G++ W++  + ++  ++l q+k ++q+
  Pp3c7_16800V3.3.p 1429 SWTQEEKEKFAVILQEHGKD-WTLLHQSLP-SKSLTQIKTYFQN 1470
                         7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-11861922IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-4870918IPR009057Homeodomain-like
PROSITE profilePS5129315.008872923IPR017884SANT domain
SMARTSM007174.7E-9873921IPR001005SANT/Myb domain
PfamPF002494.8E-6875917IPR001005SANT/Myb domain
CDDcd001677.53E-7876918No hitNo description
SuperFamilySSF466894.95E-1210891150IPR009057Homeodomain-like
PROSITE profilePS5129317.43610981149IPR017884SANT domain
SMARTSM007174.9E-1110991147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-811011146IPR009057Homeodomain-like
PfamPF002492.2E-1011021143IPR001005SANT/Myb domain
CDDcd001677.51E-811031141No hitNo description
Gene3DG3DSA:1.10.10.603.9E-714221473IPR009057Homeodomain-like
SuperFamilySSF466892.58E-1014241474IPR009057Homeodomain-like
PROSITE profilePS5129310.5414251476IPR017884SANT domain
SMARTSM007173.0E-814261474IPR001005SANT/Myb domain
PfamPF002496.9E-814291470IPR001005SANT/Myb domain
CDDcd001671.01E-514291472No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2119 aa     Download sequence    Send to blast
MDKEVKEVLQ SQVIALKEGK MEASLQCLSP LVQPAPRYES SSDRVHLPAT MHSVMAETTN  60
DAEDRFTRPR SASFASSVQP KSANITRTEP PIDRKTIRHI GRFEVRRGRF DNWDDHDGEN  120
LSWLSSTRDL RNSDEARRGK DDRVLGRSDD IDRKEERGLR RLDERSERDE MRRVRSDVFG  180
EVSSVRGLTI MDEQERDRDR EYRQDGGSGE GVGRMMQRKP SFSGPMAQFG SGKGWGVGDK  240
KSELSRFERY GTGNRDGSRA EYEGNSRDLG FPYGWRRERS QSSAIARHSS FTSGNRSFGE  300
HGGKGSLSVS SGHDSPFVTG LSSNQDSDHP SPSKRPRLGW GQGLAKYEKK VGDTEDVSPS  360
VVRFDSKKDG DGEIHSNAEE VKKGNVSHEK LPEATPSGVS SSDLQKPCPM VGIQPEDGEG  420
FSDGLEKREK NENKSFLWRD HVRREESGEN SNSCALLGII PRIGDVKNPV VTEEMQRLEQ  480
IPASPVRMKD SANSTEEQKN ESKCPLSNGI EEPELNGLDP VSHVLVEDSE SREKNDEVTA  540
SELQESESLG RKNQSLVPSV SKVEWDFKCS AHAKTTEVLG DSHQTVNIGE KIKVEGVLEL  600
EPARKLSKSM DLDEDEDVRG VPLESADLNI DEGVVVVSSR SSPLSAVSEK SSYYEEQSDY  660
EVATGGSSLQ EHSLSMEESL MMENKENARL AGASFLHLLP ENLKREPYQQ LYDSPTEALV  720
WQHNVETHKK IEDMLLKKIS EKHHFHKFKE RILTLRFIAL KEAWKQEQKG LSGLRNRPKS  780
VSRWDNEGRS SHGPPSQRFS LRLRPPSMNR LDSESDAAKA MKKLMKEPRV EALRPVLKMP  840
AMILDEKERA SRRFVSRNAL VEDPVTVEME RKTLNPWTEV EKKIFVEKFA LHYKNFKEIA  900
SHLQYKTTAD CIEYYYRNQK SESFSKSKEG GHSKSLGDRT KPSTFLTPTA VAIKRNLKAN  960
CATVEALNVA TMNMKVSQLS SQVSEHAKTM TSSNHSLSMP ADAKIRKSHL KESKVLEVIL  1020
PSGTSVETVT SSLISTPCSV SSTAVPLTDE CKEKGFVKER VGRGPSATRS SHSEQHLAGP  1080
KSTRSTYLRR MSSKAATQEG SQWTDEEREL FTSAVATHGK DFRLIAAHVG SKSQSQCKSF  1140
FSKTRKRLGL DELVEQFQAN EAAAMLVQSF RHDAELLQEV KQISTAQMDA SAGVVGHSVD  1200
ELSDTAAAVS TLERLKEQSK CFANDMSDLS LVADAAAAME EMSLMKSESP SRDFSNNKQL  1260
LEIAELAHEH LKVEPSNIAA IRQEGEDDSE TTKSDDSCQV DTQAEIDIVV DQAAAALLGM  1320
SETLVDNSGL KRSKSEAKVG TRTSPVSVFS RSQSARLSTS SPPLHAVFET NVCLTSGRNS  1380
RQAKERVNST TSCKPTTRDR PQDMQDAQSG RKGKDTGGGE PKLRREPTSW TQEEKEKFAV  1440
ILQEHGKDWT LLHQSLPSKS LTQIKTYFQN SKARSRLPAV VKLMNVVRRD GGSRKRKAEG  1500
YESSRKAAEL GPPFKQKVRA NAASHEFDDT TQEEDNLFRS ASVSGGTGVG VDILAYAARF  1560
GTYPGQPINQ DTLSMNGMQH LARPMPTSNT YVQESKQDGH QAFRSGARPV LPTPLGIRPH  1620
VGDGLLRQLS SSVPSKACSP DLQVLSSNVG PQAEPPAAIH QVAQQVQQML AQQQHLQKQL  1680
ALLIQQQAAL PQALLPQHQQ ATEQTLQSAR PLEEKLQQVV QQLQQQQALA QSQEGEIHNH  1740
MHFQYQQAPH GRGILKVKPI REAISNPFAD LAILPSPDVL QNQHISRNQE IQLQQQDHSL  1800
SLGMRTIPST AGGSTAGLHE NHSKTLDLQD SDTDTDTDCE GMGSKQMVAE DSHQRMSVVH  1860
SSSSGQQQGA AQSTTSTLSS DSEQVKSWDV KLFGQSLLSK PTALPSTMPR ITGSSIQEFV  1920
KPNISSPVAT VTYPAGSLSK EFKPSESLPS AFGRVGASSS VAEGQPTSWA GMSSLLEKLG  1980
VYGAWSTTSS LQLSEVTELS RKEPDSEGTQ DAVTSMPTIP DRQHTDNQDL VLTSEQGPQR  2040
DDGHHDGERE LSACQSETRG RETTVEETPF LGRIQNCSSE NVVSLDAGQC QIGLDSALPA  2100
SHMKSFPTVS AEPGHWGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D5e-17832924293NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C5e-17832924293NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.168350.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751861.10.0predicted protein
TrEMBLA9RCH60.0A9RCH6_PHYPA; Predicted protein
STRINGPP1S2_775V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-40MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]